PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462939746
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family NAC
Protein Properties Length: 315aa    MW: 35497.3 Da    PI: 6.6299
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462939746genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM38.53.4e-12544141
        NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiyk 41
               lppGfrFhPtdeelv++yL++kv++  +++ ++i++vd++k
  462939746  5 LPPGFRFHPTDEELVTYYLTRKVSDFGFTT-RAIADVDLNK 44
               79*************************999.88*****997 PP

2NAM180.83.5e-56501751128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                lppGfrFhPtdeelv++yL++kv++  +++ ++i++vd++k+ePwdLp+k++ +ekewyfFs rd+ky+tg r+nrat+sgyWk+tgkdke+++  g lv
  462939746  50 LPPGFRFHPTDEELVTYYLTRKVSDFGFTT-RAIADVDLNKCEPWDLPSKASMGEKEWYFFSMRDRKYPTGIRTNRATDSGYWKTTGKDKEIFQ-AGMLV 147
                79*************************999.89***************999999****************************************.999** PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                g+kktLvfy+grapkgekt+Wvmheyrl
  462939746 148 GMKKTLVFYRGRAPKGEKTSWVMHEYRL 175
                **************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.67E-13344IPR003441NAC domain
PROSITE profilePS510058.47551IPR003441NAC domain
PfamPF023651.5E-7628IPR003441NAC domain
SuperFamilySSF1019411.96E-6447195IPR003441NAC domain
PROSITE profilePS5100560.28750195IPR003441NAC domain
PfamPF023651.7E-2951175IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MEEGLPPGFR FHPTDEELVT YYLTRKVSDF GFTTRAIADV DLNKLMEEGL PPGFRFHPTD  60
EELVTYYLTR KVSDFGFTTR AIADVDLNKC EPWDLPSKAS MGEKEWYFFS MRDRKYPTGI  120
RTNRATDSGY WKTTGKDKEI FQAGMLVGMK KTLVFYRGRA PKGEKTSWVM HEYRLQNKFP  180
YKPSKEWVVC RVFKKCQIIK MRPPTGSPTM DSPCHDANAS LGELGELDVS SFLGGLTPAS  240
VHTSPSSPAE GFGHRVDMSA PSQTRDLGGV LANVGGDHVM FGSSVAKVDM ECDQQQQLPP  300
PEPQLGMDES TWRTF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-574519512165NO APICAL MERISTEM PROTEIN
1ut4_B3e-574519512165NO APICAL MERISTEM PROTEIN
1ut7_A3e-574519512165NO APICAL MERISTEM PROTEIN
1ut7_B3e-574519512165NO APICAL MERISTEM PROTEIN
3swm_A3e-574519515168NAC domain-containing protein 19
3swm_B3e-574519515168NAC domain-containing protein 19
3swm_C3e-574519515168NAC domain-containing protein 19
3swm_D3e-574519515168NAC domain-containing protein 19
3swp_A3e-574519515168NAC domain-containing protein 19
3swp_B3e-574519515168NAC domain-containing protein 19
3swp_C3e-574519515168NAC domain-containing protein 19
3swp_D3e-574519515168NAC domain-containing protein 19
4dul_A3e-574519512165NAC domain-containing protein 19
4dul_B3e-574519512165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3631710.0AK363171.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2013D22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982400.11e-146PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
SwissprotQ9FLJ21e-76NC100_ARATH; NAC domain-containing protein 100
TrEMBLK4ACC81e-146K4ACC8_SETIT; Uncharacterized protein
STRINGSi036535m1e-146(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.14e-94NAC domain containing protein 58